Name :
IGF1 (Human) Recombinant Protein
Biological Activity :
Human IGF1 recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.Bioactive Protein,Bioactive Proteins,Bioactive,Active,Functional Protein,Functional Proteins
Tag :
Result of activity analysis
Protein Accession No. :
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=3479
Amino Acid Sequence :
MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA with polyhistidine tag at the C-terminus.
Molecular Weight :
Storage and Stability :
Lyophilized protein should be stored at -20°C. Protein aliquots should be stored at-20°C to -80°C. This product is stable for one year. Avoid repeated freeze/thaw cycles.
Host :
Escherichia coli
Interspecies Antigen Sequence :
Preparation Method :
Escherichia coli expression system
Purification :
Ni-NTA chromatography
Quality Control Testing :
SDS-PAGE Stained with Coomassie Blue. SDS-PAGE analysis of FGF11 (Human) Recombinant Protein.
Storage Buffer :
Lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Applications :
Functional Study， SDS-PAGE，
Gene Name :
IGF1
Gene Alias :
IGFI
Gene Description :
insulin-like growth factor 1 (somatomedin C)
Gene Summary :
The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Several transcript variants encoding different isoforms have been found for this gene
Other Designations :
insulin-like growth factor 1|somatomedin C
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Integrin Associated Protein/CD47 Recombinant Proteins
IL-18BP Proteincustom synthesis
Popular categories:
Mitogen-Activated Protein Kinase 8 (MAPK8/JNK1)
Testicular Receptor 4
