Share this post on:

Name :
NGF (Human) Recombinant Protein

Biological Activity :
Human NGF (P01138) recombinant protein expressed in Escherichia coli.

Tag :

Protein Accession No. :
P01138

Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=4803

Amino Acid Sequence :
MEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA.

Molecular Weight :
25

Storage and Stability :
Store at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.

Host :
Escherichia coli

Interspecies Antigen Sequence :

Preparation Method :
Escherichia coli expression system

Purification :

Quality Control Testing :

Storage Buffer :
ProNGF was lyophilized from a 0.2 uM filtered solution of 20m Tris-HCL, 0.5M NaCl, 5% Trehalose, 5% Mannitol. 0.01% Tween-80 and 1mM EDTA pH-8.

Applications :
SDS-PAGE,

Gene Name :
NGF

Gene Alias :
Beta-NGF, HSAN5, MGC161426, MGC161428, NGFB

Gene Description :
nerve growth factor (beta polypeptide)

Gene Summary :
This gene is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the differentiation of sympathetic and certain sensory neurons. Mutations in this gene have been associated with hereditary sensory and autonomic neuropathy, type 5 (HSAN5), and dysregulation of this gene’s expression is associated with allergic rhinitis. [provided by RefSeq

Other Designations :
OTTHUMP00000013653|beta-nerve growth factor|nerve growth factor, beta polypeptide|nerve growth factor, beta subunit

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CNTF ProteinStorage & Stability
IL-5 ProteinMedChemExpress
Popular categories:
IL-6R
RSV Fusion Proteins

Share this post on:

Author: Menin- MLL-menin