Name :
Ccl2 (Rat) Recombinant Protein
Biological Activity :
Rat Ccl2 (P14844, 24 a.a. – 148 a.a.) partial recombinant protein with His tag at C-terminus expressed in Sf9 cells.
Tag :
Protein Accession No. :
P14844
Protein Accession No.URL :
https://www.ncbi.nlm.nih.gov/gene?cmd=Retrieve&dopt=Graphics&list_uids=24770
Amino Acid Sequence :
ADPQPDAVNAPLTCCYSFTGKMIPMSRLENYKRITSSRCPKEAVVFVTKLKREICADPNKEWVQKYIRKLDQNQVRSETTVFYKIASTLRTSAPLNVNLTHKSEANASTLFSTTTSSTSVEVTSMTENHHHHHH
Molecular Weight :
15.1
Storage and Stability :
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.Aliquot to avoid repeated freezing and thawing.
Host :
insect
Interspecies Antigen Sequence :
Preparation Method :
Sf9 cell expression system
Purification :
Quality Control Testing :
Storage Buffer :
In PBS pH 7.4 (10% glycerol)
Applications :
SDS-PAGE，
Gene Name :
Ccl2
Gene Alias :
MCP-1, Scya2, Sigje
Gene Description :
chemokine (C-C motif) ligand 2
Gene Summary :
Other Designations :
monocyte chemoattractant protein-1|monocyte chemotactic protein 1|small inducible cytokine A2|small inducible gene JE
MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD3d site
Delta-like 3 (DLL3) web
Popular categories:
ADAM33
Ephrins
